PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma50g00830.1
Common NameZOSMA_50G00830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 369aa    MW: 40447.1 Da    PI: 6.7591
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma50g00830.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-092923262155
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      k +yps++++  LA+++gL+ +q+ +WF N+R ++
  Zosma50g00830.1 292 KWPYPSESQKLALAESTGLDPKQINNWFINQRKRH 326
                      469*****************************885 PP

2ELK33.31.1e-11246267122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLlr YsgyLgsLk+EF+
  Zosma50g00830.1 246 ELKGQLLRRYSGYLGSLKKEFL 267
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.4E-1692136IPR005540KNOX1
PfamPF037903.8E-2194131IPR005540KNOX1
SMARTSM012561.1E-24141192IPR005541KNOX2
PfamPF037912.7E-20145190IPR005541KNOX2
PfamPF037892.7E-9246267IPR005539ELK domain
PROSITE profilePS5121310.772246266IPR005539ELK domain
SMARTSM011888.1E-7246267IPR005539ELK domain
PROSITE profilePS5007112.843266329IPR001356Homeobox domain
SuperFamilySSF466891.07E-19268345IPR009057Homeodomain-like
SMARTSM003892.4E-13268333IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-28271331IPR009057Homeodomain-like
CDDcd000861.31E-12278329No hitNo description
PfamPF059205.9E-17286325IPR008422Homeobox KN domain
PROSITE patternPS000270304327IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MDHSNGGGGF MGFGDAGGSG LSPLMMMPPT HHHPSSSSDH HHHHNQHQQS NGNIFFLSNL  60
NSTNPCSSNN SGGGGSSINN NANLLLPFAE GDNIKSKIMS HPHYPRLLSA YVNCHKIGAP  120
PEVVAKLEQA CNIGGRSGGG GGTNLGEDPA LDQFMEAYCE MLTKYEEEIS KPFKEAMLFF  180
SRVESQFKSL SLAAIAASPS SPSPVPIIQQ GGSGGGGNLE KYGSSDEDGI DMDDENYIDP  240
QAEDRELKGQ LLRRYSGYLG SLKKEFLKKR KKGKLPKEAR QQLLDWWNRH LKWPYPSESQ  300
KLALAESTGL DPKQINNWFI NQRKRHWKPT EEMQFVVMDA AHPSHYYFEN GYSSANPFSV  360
DCGGTSLF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141GGRSGGGGG
2261270LKKEFLKKRK
3267271KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010244154.11e-126PREDICTED: homeobox protein SBH1
SwissprotP466081e-117HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0K9NY030.0A0A0K9NY03_Z
STRINGVIT_12s0059g01190.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2107357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-101KNOX/ELK homeobox transcription factor